Jagged 2 Recombinant Protein Antigen

Images

 
There are currently no images for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Jagged 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAG2.

Source: E. coli

Amino Acid Sequence: LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JAG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86337.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Jagged 2 Recombinant Protein Antigen

  • HJ2
  • JAG2
  • Jagged 2
  • Jagged2
  • protein jagged-2
  • SER2

Background

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
AF3847
Species: Hu
Applications: ICC, WB
1277-JG
Species: Hu
Applications: BA
AF3735
Species: Hu
Applications: IHC, WB
H00004854-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF1389
Species: Mu
Applications: ICC, IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF5026
Species: Mu, Rt
Applications: IHC, WB
AF8277
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-27174
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-13382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-24669
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA

Publications for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP) (0)

There are no publications for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP) (0)

There are no reviews for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jagged 2 Products

Research Areas for Jagged 2 Recombinant Protein Antigen (NBP1-86337PEP)

Find related products by research area.

Blogs on Jagged 2.

Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge
We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Jagged 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JAG2