ITPKB Antibody (2F8)

Images

 
Western Blot: ITPKB Antibody (2F8) [H00003707-M01] - ITPKB monoclonal antibody (M01), clone 2F8 Analysis of ITPKB expression in Jurkat.
Western Blot: ITPKB Antibody (2F8) [H00003707-M01] - Analysis of ITPKB expression in transfected 293T cell line by ITPKB monoclonal antibody (M01), clone 2F8.Lane 1: ITPKB transfected lysate(67.4 KDa).Lane 2: ...read more
Sandwich ELISA: ITPKB Antibody (2F8) [H00003707-M01] - Detection limit for recombinant GST tagged ITPKB is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ITPKB Antibody (2F8) Summary

Immunogen
ITPKB (NP_002212 545 a.a. - 643 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR
Specificity
ITPKB - inositol 1,4,5-trisphosphate 3-kinase B
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITPKB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00003707-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ITPKB Antibody (2F8)

  • EC 2.7.1.127
  • inositol 14,5-trisphosphate 3-kinase BIP3K
  • inositol-trisphosphate 3-kinase B
  • InsP 3-kinase B
  • IP3 3-kinase B
  • IP3-3KB
  • IP3K B
  • IP3KB
  • IP3K-B
  • PIG37
  • proliferation-inducing protein 37

Background

The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-49068
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-86712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for ITPKB Antibody (H00003707-M01)(1)

Reviews for ITPKB Antibody (H00003707-M01) (0)

There are no reviews for ITPKB Antibody (H00003707-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITPKB Antibody (H00003707-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITPKB Products

Bioinformatics Tool for ITPKB Antibody (H00003707-M01)

Discover related pathways, diseases and genes to ITPKB Antibody (H00003707-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITPKB Antibody (H00003707-M01)

Discover more about diseases related to ITPKB Antibody (H00003707-M01).
 

Pathways for ITPKB Antibody (H00003707-M01)

View related products by pathway.

PTMs for ITPKB Antibody (H00003707-M01)

Learn more about PTMs related to ITPKB Antibody (H00003707-M01).

Blogs on ITPKB

There are no specific blogs for ITPKB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITPKB Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPKB
Entrez
OMIM
Uniprot