ITIH2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ITIH2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITIH2.
  
  

  Source: E. coli

  Amino Acid Sequence: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ITIH2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31750.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ITIH2 Recombinant Protein Antigen

• H2P
• IGHEP2
• Inter-Alpha (Globulin) Inhibitor H2
• inter-alpha (globulin) inhibitor, H2 polypeptide
• Inter-alpha-inhibitor heavy chain 2
• Inter-alpha-trypsin inhibitor complex component II
• inter-alpha-trypsin inhibitor heavy chain H2
• Intin2
• ITI Heavy Chain H2
• ITIH2
• ITI-H2
• ITI-HC2
• Serum-derived hyaluronan-associated protein
• SHAP

Background

The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain (see MIM 176870) and a variable number of heavy chains (Salier et al., 1987 (PubMed 2446322); Himmelfarb et al., 2004 (PubMed 14744536)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ITIH2 Recombinant Protein Antigen (NBP2-31750PEP)(1)

Publication using NBP2-31750PEP

• Yvonne Azasi, Leanne M Low, Ashley N Just, Sai S R Raghavan, Christian W Wang, Paola Valenzuela-Leon, J Alexandra Rowe, Joseph D Smith, Thomas Lavstsen, Louise Turner, Eric Calvo, Louis H Miller Complement C1s cleaves PfEMP1 at interdomain conserved sites inhibiting Plasmodium falciparum cytoadherence. Proceedings of the National Academy of Sciences of the United States of America 2021-12-09 [PMID: 34035177]

Bioinformatics

• Gene Symbol: ITIH2