IRX6 Antibody

Images

 
Western Blot: IRX6 Antibody [NBP1-80245] - Titration: 1.25ug/ml, Positive Control: NIH/3T3 cell lysate.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRX6 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of mouse IRX6. Peptide sequence RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGNSTFTLQGLPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRX6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against IRX6 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IRX6 Antibody

  • iroquois homeobox 6
  • Iroquois homeobox protein 6Homeodomain protein IRXB3
  • iroquois homeobox protein 7
  • iroquois-class homeodomain protein IRX-6
  • IRX-3
  • IRX7IRXB3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010265-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00079191-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83090
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00153572-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBL1-12041
Species: Hu
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP2-14279
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14253
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-80245
Species: Mu
Applications: WB

Publications for IRX6 Antibody (NBP1-80245) (0)

There are no publications for IRX6 Antibody (NBP1-80245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRX6 Antibody (NBP1-80245) (0)

There are no reviews for IRX6 Antibody (NBP1-80245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRX6 Antibody (NBP1-80245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRX6 Products

Bioinformatics Tool for IRX6 Antibody (NBP1-80245)

Discover related pathways, diseases and genes to IRX6 Antibody (NBP1-80245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRX6 Antibody (NBP1-80245)

Discover more about diseases related to IRX6 Antibody (NBP1-80245).
 

Pathways for IRX6 Antibody (NBP1-80245)

View related products by pathway.

Blogs on IRX6

There are no specific blogs for IRX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRX6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRX6
Uniprot