IRS1 Antibody (3Q8A2)

Western Blot: IRS1 Antibody (3Q8A2) [IRS1] - Western blot analysis of lysates from HepG2 cells, using IRS1 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3min.

• Reactivity: Hu
• Applications: WB
• Clone: 3Q8A2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IRS1 Antibody (3Q8A2) Summary

• Description: Novus Biologicals Rabbit IRS1 Antibody (3Q8A2) (NBP3-15648) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568). SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IRS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IRS1 Antibody (3Q8A2)

• HIRS-1
• insulin receptor substrate 1
• IRS1
• IRS-1

Background

Insulin receptor substrates (IRS), the major intracellular substrates of the insulin receptor (IR), are adaptor proteins that transduce signals from the IR to downstream effectors that are important for the biological effect of insulin (1-2). After insulin stimulation, IRS proteins are rapidly phosphorylated on multiple tyrosine residues. Once phosphorylated, IRS proteins bind and activate Grb-2, SHP2 and the PI3-K p85 subunit (2-3). IRS-1 functions as one of the key regulators of IR and the insulin-like growth factor-1 receptor. Disruption of IRS-1 causes growth retardation and insulin resistance associated with hypertension, hypertriglyceridemia, and impaired endothelium-dependent vascular relaxation (4-5)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IRS1