IRF2BPL Antibody

Images

 
Orthogonal Strategies: Western Blot: IRF2BPL Antibody [NBP2-56241] - Analysis in human cell lines PC-3 and Caco-2 using Anti-IRF2BPL antibody. Corresponding IRF2BPL RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: IRF2BPL Antibody [NBP2-56241] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

IRF2BPL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
Specificity
Specificity of human IRF2BPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRF2BPL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRF2BPL Recombinant Protein Antigen (NBP2-56241PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IRF2BPL Antibody

  • C14orf4
  • EAP1
  • IRF2BPL interferon regulatory factor 2 binding protein-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB100-56479
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Po
Applications: WB, IP
NBP1-06066
Species: Hu
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46162
Species: Hu
Applications: WB, IHC
NBP2-50071
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-93674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF6800
Species: Hu
Applications: WB, ICC
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for IRF2BPL Antibody (NBP2-56241) (0)

There are no publications for IRF2BPL Antibody (NBP2-56241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF2BPL Antibody (NBP2-56241) (0)

There are no reviews for IRF2BPL Antibody (NBP2-56241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF2BPL Antibody (NBP2-56241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IRF2BPL Products

Bioinformatics Tool for IRF2BPL Antibody (NBP2-56241)

Discover related pathways, diseases and genes to IRF2BPL Antibody (NBP2-56241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF2BPL Antibody (NBP2-56241)

Discover more about diseases related to IRF2BPL Antibody (NBP2-56241).
 

Pathways for IRF2BPL Antibody (NBP2-56241)

View related products by pathway.

Blogs on IRF2BPL

There are no specific blogs for IRF2BPL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF2BPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF2BPL