![Western Blot: IRF2BPL Antibody [NBP2-14712] - Analysis in human cell lines PC-3 and Caco-2 using anti-IRF2BPL antibody. Corresponding IRF2BPL RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Western-Blot-NBP2-14712-img0012.jpg "Western Blot: IRF2BPL Antibody [NBP2-14712] - Analysis in human cell lines PC-3 and Caco-2 using anti-IRF2BPL antibody. Corresponding IRF2BPL RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IRF2BPL Antibody - BSA Free (NBP2-14712) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-IRF2BPL Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IRF2BPL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-14712 | Applications | Species |
|---|---|---|
| Sinha Ray S, Dutta D, Dennys C et al. Mechanisms of IRF2BPL-related disorders and identification of a potential therapeutic strategy Cell reports 2022-12-06 [PMID: 36476864] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IRF2BPL |
![Immunocytochemistry/Immunofluorescence: IRF2BPL Antibody [NBP2-14712] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14712-img0005.jpg "Immunocytochemistry/Immunofluorescence: IRF2BPL Antibody [NBP2-14712] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human testis shows moderate positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Immunohistochemistry-Paraffin-NBP2-14712-img0017.jpg "Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human testis shows moderate positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Immunohistochemistry-Paraffin-NBP2-14712-img0014.jpg "Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Immunohistochemistry-Paraffin-NBP2-14712-img0015.jpg "Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/IRF2BPL-Antibody-Immunohistochemistry-Paraffin-NBP2-14712-img0016.jpg "Immunohistochemistry-Paraffin: IRF2BPL Antibody [NBP2-14712] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.")
![Western Blot eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81898_rabbit-polyclonal-eif4e-p-ser209-antibody-10320252346451.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/nb100-81898_rabbit-polyclonal-eif4e-p-ser209-antibody-10320252346452.jpg)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")