IRAK1BP1 Antibody

Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP2-34019] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP2-34019] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP2-34019] - Staining of human bone marrow shows moderate to strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP2-34019] - Staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.

Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP2-34019] - Staining of human endometrium shows moderate to strong positivity in glandular cells.

Product Discontinued

IRAK1BP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGS
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IRAK1BP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IRAK1BP1 Antibody

• ActA binding protein 3,4921528N06Rik
• AIP70
• interleukin-1 receptor-associated kinase 1 binding protein 1
• interleukin-1 receptor-associated kinase 1-binding protein 1
• MGC138458
• MGC138460
• SIMPL

Background

IRAK1BP1 is a component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and isrequired for cell survival. Acts by enhancing RELA transcriptional activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IRAK1BP1
• Uniprot:
  • Q5VVH5(Human)