IP3R1 Antibody

Images

 
Western Blot: IP3R1 Antibody [NBP1-83105] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-87 MG
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-83105] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IP3R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITPR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IP3R1 Protein (NBP1-83105PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IP3R1 Antibody

  • DKFZp313E1334
  • DKFZp313N1434
  • inositol 14,5-triphosphate receptor, type 1
  • inositol 14,5-trisphosphate receptor type 1
  • INSP3R1
  • IP3 receptor isoform 1
  • IP3 receptor
  • IP3R 1
  • IP3R
  • IP3R1
  • SCA15
  • SCA16
  • spinocerebellar ataxia 15
  • spinocerebellar ataxia 16
  • Type 1 inositol 14,5-trisphosphate receptor
  • Type 1 InsP3 receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
AF2364
Species: Hu
Applications: WB, IHC
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NB100-2466
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-83105
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for IP3R1 Antibody (NBP1-83105) (0)

There are no publications for IP3R1 Antibody (NBP1-83105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IP3R1 Antibody (NBP1-83105) (0)

There are no reviews for IP3R1 Antibody (NBP1-83105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IP3R1 Antibody (NBP1-83105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IP3R1 Products

Bioinformatics Tool for IP3R1 Antibody (NBP1-83105)

Discover related pathways, diseases and genes to IP3R1 Antibody (NBP1-83105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IP3R1 Antibody (NBP1-83105)

Discover more about diseases related to IP3R1 Antibody (NBP1-83105).
 

Pathways for IP3R1 Antibody (NBP1-83105)

View related products by pathway.

PTMs for IP3R1 Antibody (NBP1-83105)

Learn more about PTMs related to IP3R1 Antibody (NBP1-83105).
 

Research Areas for IP3R1 Antibody (NBP1-83105)

Find related products by research area.

Blogs on IP3R1

There are no specific blogs for IP3R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IP3R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPR1