IP3R1 Antibody (4Z1B6)

Western Blot: IP3R1 Antibody (4Z1B6) [NBP3-16414] - Western blot analysis of extracts of Mouse brain, using IP3R1 Rabbit mAb (NBP3-16414) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry: IP3R1 Antibody (4Z1B6) [NBP3-16414] - Immunofluorescence analysis of mouse brain using IP3R1 Rabbit mAb (NBP3-16414) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: IP3R1 Antibody (4Z1B6) [NBP3-16414] - Immunohistochemistry of paraffin-embedded rat brain using IP3R1 Rabbit mAb (NBP3-16414) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: IP3R1 Antibody (4Z1B6) [NBP3-16414] - Immunohistochemistry of paraffin-embedded mouse brain using IP3R1 Rabbit mAb (NBP3-16414) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: IP3R1 Antibody (4Z1B6) [NBP3-16414] - Immunofluorescence analysis of rat brain using IP3R1 Rabbit mAb (NBP3-16414) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4Z1B6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IP3R1 Antibody (4Z1B6) Summary

• Description: Novus Biologicals Rabbit IP3R1 Antibody (4Z1B6) (NBP3-16414) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2200-2300 of human IP3R1 (Q14643). HTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ITPR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IP3R1 Antibody (4Z1B6)

• DKFZp313E1334
• DKFZp313N1434
• inositol 14,5-triphosphate receptor, type 1
• inositol 14,5-trisphosphate receptor type 1
• InsP3R1
• IP3 receptor isoform 1
• IP3 receptor
• IP3R 1
• IP3R
• IP3R1
• ITPR1
• SCA15
• SCA16
• spinocerebellar ataxia 15
• spinocerebellar ataxia 16
• Type 1 inositol 14,5-trisphosphate receptor
• Type 1 InsP3 receptor

Background

IP3R1 (inositol 1,4,5-triphosphate receptor type 1) is an intracellular calcium release channel that mediates calcium release from the endoplasmic reticulum. There are 3 mammalian InsP3R receptors: Insp3R1, Insp3R2, and Insp3R3. Defects in the gene which encodes InsP3R1, ITPR1, are the cause of spinocerebellar ataxia type 15 (SCA15).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPR1