We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

INTS6 Recombinant Protein Antigen

Images

 
There are currently no images for INTS6 Protein (NBP1-88029PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

INTS6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INTS6.

Source: E. coli

Amino Acid Sequence: KYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INTS6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88029.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INTS6 Recombinant Protein Antigen

  • DBI1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26
  • DICE1DBI-1DDX26ADDX26DEAD box protein
  • DKFZp434B105
  • HDB
  • INT6
  • integrator complex subunit 6
  • Notchl2
  • Protein DDX26
  • Protein deleted in cancer 1
  • RNA helicase HDB

Background

The tumor suppressor gene DICE1 is located within a previously reported critical region of loss of heterozygosity on chromosome 13q14.3. Expression of the remaining DICE1 allele is down-regulated in non-small cell lung carcinomas. In IGF-IR transformed Balb/c 3T3, DICE1 substantially suppressed growth in soft agar. These results demonstrate that DICE1 has a growth-suppressing activity and interferes with anchorage-independent growth of IGF-IR transformed tumor cells dependent upon IGF-I signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NBP1-84869
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP2-13306
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1157
Species: Mu
Applications: IHC, WB
NBP3-35268
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-76491
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF6116
Species: Hu
Applications: ICC, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47427
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
1206-F3
Species: Hu
Applications: BA

Publications for INTS6 Protein (NBP1-88029PEP) (0)

There are no publications for INTS6 Protein (NBP1-88029PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INTS6 Protein (NBP1-88029PEP) (0)

There are no reviews for INTS6 Protein (NBP1-88029PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for INTS6 Protein (NBP1-88029PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INTS6 Products

Research Areas for INTS6 Protein (NBP1-88029PEP)

Find related products by research area.

Blogs on INTS6

There are no specific blogs for INTS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INTS6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS6