Integrin beta 7 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:WCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGB7 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Integrin beta 7 Antibody
Background
Integrin beta7 is a 130 kD glycoprotein, also known as integin betap. It is a member of the Ig superfamily. In association with integrin alpha4 or alphaE chain, beta7 forms alpha4/ beta7 or alphaE/ beta7 heterodimer. alpha4/ beta7 (CD49d/ beta7, LPAM-1) is expressed on majority of peripheral lymphocytes, small subsets of thymocytes and bone marrow progenitors. LPAM-1 binds to several ligands, VCAM-1, MAdCAM-1 and fibronectin, and is involved in lymphocyte adhesion, some hematopoietic progenitor cells migration. alphaE/ beta7 (CD103/ beta7, alphaIEL/ beta7) is expressed on intestinal intraepithelial lymphocytes (IEL), dendritic epidermal T cells, T regulatory cells, a subset of CD8+ T cells in lymph nodes and lamina propria. CD103/ beta7 complex is thought to play a role in lymphocyte retention via interaction with its lignd E-Cadherin. The Fib504 antibody has been reported to react with mouse and human beta7 integrin and to block beta7 integrin-mediated cell adhesion in in vitro and in vivo studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for Integrin beta 7 Antibody (NBP1-87412) (0)
There are no publications for Integrin beta 7 Antibody (NBP1-87412).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin beta 7 Antibody (NBP1-87412) (0)
There are no reviews for Integrin beta 7 Antibody (NBP1-87412).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 7 Antibody (NBP1-87412) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin beta 7 Products
Research Areas for Integrin beta 7 Antibody (NBP1-87412)
Find related products by research area.
|
Blogs on Integrin beta 7