Integrin alpha 9 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human Integrin alpha 9 (NP_002198.2). Peptide sequence ISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKN |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGA9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
113 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Integrin alpha 9 Antibody - BSA Free
Background
Integrin alpha-9 is a protein that functions as a receptor for VCAM1, osteopontin and cytotactin, is located in the airway epithelium, smooth muscle, hepatocytes, and skeletal muscle and is encoded by a gene comprised of 1035 amino acids and weighs approximately 114 kDa. Studies are being conducted on several diseases and disorders related to this protein, including lung cancer, Lynch syndrome, hypertension, PANDAS, medulloblastoma, carcinoma, nasopharyngitis, colorectal cancer, breast cancer, arthritis, and melanoma. Integrin alpha-9 has also been shown to have interactions with FIGF, ITGB7, SAT1, SPP1, and ITGB1 in pathways such as the CDK5, Tec kinases signaling, integrin-mediated cell adhesion, signal transduction, and hypertrophic cardiomyopathy pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Ca, Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Publications for Integrin alpha 9 Antibody (NBP3-10039) (0)
There are no publications for Integrin alpha 9 Antibody (NBP3-10039).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin alpha 9 Antibody (NBP3-10039) (0)
There are no reviews for Integrin alpha 9 Antibody (NBP3-10039).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin alpha 9 Antibody (NBP3-10039) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin alpha 9 Products
Blogs on Integrin alpha 9