Integrin alpha 9 Antibody - BSA Free

Western Blot: Integrin alpha 9 Antibody [NBP3-10039] - Western blot analysis of Integrin alpha 9 in Human Neurofibroma Tumor lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Integrin alpha 9 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Integrin alpha 9 (NP_002198.2). Peptide sequence ISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 113 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Integrin alpha 9 Antibody - BSA Free

• ALPHA-RLC
• Integrin alpha 9
• integrin alpha-9
• Integrin alpha-RLC
• integrin, alpha 9
• ITGA4L
• ITGA9
• RLC
• RLC-alpha

Background

Integrin alpha-9 is a protein that functions as a receptor for VCAM1, osteopontin and cytotactin, is located in the airway epithelium, smooth muscle, hepatocytes, and skeletal muscle and is encoded by a gene comprised of 1035 amino acids and weighs approximately 114 kDa. Studies are being conducted on several diseases and disorders related to this protein, including lung cancer, Lynch syndrome, hypertension, PANDAS, medulloblastoma, carcinoma, nasopharyngitis, colorectal cancer, breast cancer, arthritis, and melanoma. Integrin alpha-9 has also been shown to have interactions with FIGF, ITGB7, SAT1, SPP1, and ITGB1 in pathways such as the CDK5, Tec kinases signaling, integrin-mediated cell adhesion, signal transduction, and hypertrophic cardiomyopathy pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA9