INPP5A Antibody [mFluor Violet 500 SE]

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

INPP5A Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-200 of human INPP5A (NP_005530.3).
  
  Sequence:
  TAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for INPP5A Antibody [mFluor Violet 500 SE]

• 43 kDa inositol polyphosphate 5-phophatase
• CTCL tumor antigen HD-CL-02,5PTASE
• DKFZp434A1721
• EC 3.1.3.56
• inositol polyphosphate-5-phosphatase, 40kD
• inositol polyphosphate-5-phosphatase, 40kDa
• inositol trisphosphate-5-phosphatase, 40kD
• InsP3 5-phosphatase
• MGC116947,5PTase
• MGC116949
• type I inositol-14,5-trisphosphate 5-phophatase
• type I inositol-14,5-trisphosphate 5-phosphatase

Background

INPP5A is a gene which codes for a protein that functions as a major isoenzyme that hydrolyzes the calcium-mobilizing second messenger Ins(1,4,5)P3 in a signal-terminating reaction and is comprised of 412 amino acids, with a mass of approximately 48 kDa. Studies are being conducted in several diseases and disorders relating to this gene including oculocerebrorenal syndrome, cutaneous T cell lymphoma, squamous cell carcinoma, Fanconi syndrome, schizophrenia, carcinoma, and olivopontocerebellar atrophy. INPP5A has also been shown to have interactions with PLEK, YWHAZ, GRB2, INPP1, and IPMK in pathways such as the inositol phosphate metabolism pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP5A