INPP5A Antibody [mFluor Violet 450 SE] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 10-200 of human INPP5A (NP_005530.3).
Sequence: TAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
INPP5A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for INPP5A Antibody [mFluor Violet 450 SE]
Background
INPP5A is a gene which codes for a protein that functions as a major isoenzyme that hydrolyzes the calcium-mobilizing second messenger Ins(1,4,5)P3 in a signal-terminating reaction and is comprised of 412 amino acids, with a mass of approximately 48 kDa. Studies are being conducted in several diseases and disorders relating to this gene including oculocerebrorenal syndrome, cutaneous T cell lymphoma, squamous cell carcinoma, Fanconi syndrome, schizophrenia, carcinoma, and olivopontocerebellar atrophy. INPP5A has also been shown to have interactions with PLEK, YWHAZ, GRB2, INPP1, and IPMK in pathways such as the inositol phosphate metabolism pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Rt
Applications: WB
Species: Ca, Fe, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IB, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB, ELISA
Publications for INPP5A Antibody (NBP3-38035MFV450) (0)
There are no publications for INPP5A Antibody (NBP3-38035MFV450).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for INPP5A Antibody (NBP3-38035MFV450) (0)
There are no reviews for INPP5A Antibody (NBP3-38035MFV450).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for INPP5A Antibody (NBP3-38035MFV450) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional INPP5A Products
Research Areas for INPP5A Antibody (NBP3-38035MFV450)
Find related products by research area.
|
Blogs on INPP5A