INPP4A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: INPP4A Antibody [NBP1-92023] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & nuclear membrane.
Immunohistochemistry-Paraffin: INPP4A Antibody [NBP1-92023] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INPP4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDT
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INPP4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
INPP4A Protein (NBP1-92023PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INPP4A Antibody

  • inositol polyphosphate-4-phosphatase, type I, 107kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-94173
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-05081
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-13510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80973
Species: Hu
Applications: WB, IHC, IHC-P, KD
H00003636-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF
NBP2-56977
Species: Hu
Applications: WB, ICC/IF
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-84399
Species: Hu
Applications: WB
NBP1-88191
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for INPP4A Antibody (NBP1-92023) (0)

There are no publications for INPP4A Antibody (NBP1-92023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP4A Antibody (NBP1-92023) (0)

There are no reviews for INPP4A Antibody (NBP1-92023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for INPP4A Antibody (NBP1-92023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional INPP4A Products

Bioinformatics Tool for INPP4A Antibody (NBP1-92023)

Discover related pathways, diseases and genes to INPP4A Antibody (NBP1-92023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP4A Antibody (NBP1-92023)

Discover more about diseases related to INPP4A Antibody (NBP1-92023).
 

Pathways for INPP4A Antibody (NBP1-92023)

View related products by pathway.

PTMs for INPP4A Antibody (NBP1-92023)

Learn more about PTMs related to INPP4A Antibody (NBP1-92023).

Blogs on INPP4A

There are no specific blogs for INPP4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP4A