INMT Recombinant Protein Antigen

Images

 
There are currently no images for INMT Recombinant Protein Antigen (NBP2-57073PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

INMT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INMT.

Source: E. coli

Amino Acid Sequence: RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INMT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57073.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INMT Recombinant Protein Antigen

  • Amine N-methyltransferase
  • Aromatic alkylamine N-methyltransferase
  • Arylamine N-methyltransferase
  • EC 2.1.1
  • EC 2.1.1.49
  • Indolamine N-methyltransferase
  • indolethylamine N-methyltransferase
  • MGC125940
  • MGC125941
  • nicotine N-methyltransferase

Background

INMT is a gene which codes for a protein that functions as a thioether S-methyltransferase which is necessary in the detoxification of selenium compounds and the catalyzation of the N-methylations of tryptamine and compounds with similar structures and has two isoforms with lengths of 263 and 262 amino acids, that both have a weight of approximately 29 kDa. Current studies are being done on diseases and disorders relating to this gene including appendicitis, homosydteine, thryoditis, and carcinoma. INMT has also been shown to interact with KCNMA1, FMO1, IDO1, AANAT, and ABP1 in pathways such as the tryptophan metabolism and selenocompound metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00537
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89495
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP1-85007
Species: Hu
Applications: IHC,  IHC-P
294-HG
Species: Hu
Applications: BA
H00003611-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
DY1857
Species: Mu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-57073PEP
Species: Hu
Applications: AC

Publications for INMT Recombinant Protein Antigen (NBP2-57073PEP) (0)

There are no publications for INMT Recombinant Protein Antigen (NBP2-57073PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INMT Recombinant Protein Antigen (NBP2-57073PEP) (0)

There are no reviews for INMT Recombinant Protein Antigen (NBP2-57073PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for INMT Recombinant Protein Antigen (NBP2-57073PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INMT Products

Research Areas for INMT Recombinant Protein Antigen (NBP2-57073PEP)

Find related products by research area.

Blogs on INMT

There are no specific blogs for INMT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INMT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INMT