INMT Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

INMT Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INMT.

  Source: E. coli

  Amino Acid Sequence: RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: INMT
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57073.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INMT Recombinant Protein Antigen

• Amine N-methyltransferase
• Aromatic alkylamine N-methyltransferase
• Arylamine N-methyltransferase
• EC 2.1.1
• EC 2.1.1.49
• Indolamine N-methyltransferase
• indolethylamine N-methyltransferase
• MGC125940
• MGC125941
• nicotine N-methyltransferase

Background

INMT is a gene which codes for a protein that functions as a thioether S-methyltransferase which is necessary in the detoxification of selenium compounds and the catalyzation of the N-methylations of tryptamine and compounds with similar structures and has two isoforms with lengths of 263 and 262 amino acids, that both have a weight of approximately 29 kDa. Current studies are being done on diseases and disorders relating to this gene including appendicitis, homosydteine, thryoditis, and carcinoma. INMT has also been shown to interact with KCNMA1, FMO1, IDO1, AANAT, and ABP1 in pathways such as the tryptophan metabolism and selenocompound metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: INMT