IMUP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IMUP Antibody [NBP2-56024] - Staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IMUP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
Specificity
Specificity of human IMUP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C19ORF33
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IMUP Recombinant Protein Antigen (NBP2-56024PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IMUP Antibody

  • C19orf33
  • chromosome 19 open reading frame 33
  • H2RSP
  • HAI-2 related small protein
  • HAI-2-related small protein
  • Hepatocyte growth factor activator inhibitor type 2-related small protein
  • immortalization up-regulated protein
  • immortalization-upregulated protein
  • IMUP
  • IMUP-1
  • IMUP-2
  • MGC39135
  • MGC75180

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1107
Species: Mu
Applications: WB, IHC
NBP2-30959
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-75718
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31411
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single-Cell Western
NBP2-56024
Species: Hu
Applications: ICC/IF

Publications for IMUP Antibody (NBP2-56024) (0)

There are no publications for IMUP Antibody (NBP2-56024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMUP Antibody (NBP2-56024) (0)

There are no reviews for IMUP Antibody (NBP2-56024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IMUP Antibody (NBP2-56024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IMUP Products

Bioinformatics Tool for IMUP Antibody (NBP2-56024)

Discover related pathways, diseases and genes to IMUP Antibody (NBP2-56024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMUP Antibody (NBP2-56024)

Discover more about diseases related to IMUP Antibody (NBP2-56024).
 

Pathways for IMUP Antibody (NBP2-56024)

View related products by pathway.

Blogs on IMUP

There are no specific blogs for IMUP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMUP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C19ORF33