Recombinant Human Importin alpha 5/KPNA1/SRP1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Importin alpha 5/KPNA1/SRP1 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 538 of Human KPNA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
KPNA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
84.92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Importin alpha 5/KPNA1/SRP1 GST (N-Term) Protein

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta

Background

KPNA1( AAH03009, 1 a.a. - 539 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79807
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-31260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
285-IF
Species: Hu
Applications: BA
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NB100-1591
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-81650
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93456
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003836-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no publications for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no reviews for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin alpha 5/KPNA1/SRP1 Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).
 

Pathways for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Importin alpha 5/KPNA1/SRP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA1