Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 538 of Human KPNA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL

Protein/Peptide Type
Recombinant Protein
Gene
KPNA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta

Background

KPNA1( AAH03009, 1 a.a. - 539 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-31260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-07799
Species: Hu
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-81650
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83762
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003836-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no publications for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no reviews for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin alpha 5/KPNA1/SRP1 Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).
 

Pathways for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Recombinant Protein (H00003836-P01).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA1
Entrez