Importin alpha 2/KPNA2 Antibody (9T3V8)

Western Blot: Importin alpha 2/KPNA2 Antibody (9T3V8) [NBP3-16530] - Western blot analysis of extracts of various cell lines, using Importin alpha 2/KPNA2 Rabbit mAb (NBP3-16530) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 9T3V8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Importin alpha 2/KPNA2 Antibody (9T3V8) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Importin alpha 2/KPNA2 (P52292). MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KPNA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Importin alpha 2/KPNA2 Antibody (9T3V8)

• Importin alpha 1
• Importin alpha 2
• importin-alpha-P1
• IPOA1
• karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
• Karyopherin subunit alpha-2
• KPNA2
• Pendulin
• QIP2
• QIP2importin alpha 2
• RAG cohort 1
• RAG cohort protein 1
• RCH1
• RCH1importin subunit alpha-2
• SRP1
• SRP1alpha
• SRP1-alpha

Background

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KPNA2