Recombinant Human IMPG2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human IMPG2 Protein [H00050939-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human IMPG2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 572-678 of Human IMPG2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IMPG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IMPG2 GST (N-Term) Protein

  • interphotoreceptor matrix proteoglycan 2
  • interphotoreceptor matrix proteoglycan 200
  • Interphotoreceptor matrix proteoglycan of 200 kDa
  • IPM 200
  • IPM200SPACRCAN
  • RP56
  • Sialoprotein associated with cones and rods proteoglycan
  • Spacrcan

Background

Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57460
Species: Hu
Applications: IHC, IHC-P
236-EG
Species: Hu
Applications: BA
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF5665
Species: Mu, Rt
Applications: IHC, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, Simple Western, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-38213
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for IMPG2 Partial Recombinant Protein (H00050939-Q01) (0)

There are no publications for IMPG2 Partial Recombinant Protein (H00050939-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMPG2 Partial Recombinant Protein (H00050939-Q01) (0)

There are no reviews for IMPG2 Partial Recombinant Protein (H00050939-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IMPG2 Partial Recombinant Protein (H00050939-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IMPG2 Products

Array H00050939-Q01

Bioinformatics Tool for IMPG2 Partial Recombinant Protein (H00050939-Q01)

Discover related pathways, diseases and genes to IMPG2 Partial Recombinant Protein (H00050939-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPG2 Partial Recombinant Protein (H00050939-Q01)

Discover more about diseases related to IMPG2 Partial Recombinant Protein (H00050939-Q01).
 

Pathways for IMPG2 Partial Recombinant Protein (H00050939-Q01)

View related products by pathway.

PTMs for IMPG2 Partial Recombinant Protein (H00050939-Q01)

Learn more about PTMs related to IMPG2 Partial Recombinant Protein (H00050939-Q01).
 

Research Areas for IMPG2 Partial Recombinant Protein (H00050939-Q01)

Find related products by research area.

Blogs on IMPG2

There are no specific blogs for IMPG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IMPG2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPG2