ILKAP/PP2C delta Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ILKAP/PP2C delta Antibody [NBP2-76549] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ILKAP/PP2C delta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ILKAP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ILKAP/PP2C delta Antibody

  • DKFZp434J2031
  • EC 3.1.3.16
  • FLJ10181
  • ILKAP
  • integrin-linked kinase-associated serine/threonine phosphatase 2C
  • integrin-linked kinase-associated serine/threonine phosphatase
  • MGC4846
  • PP2C delta
  • PP2C-DELTA
  • protein phosphatase 2c, delta isozyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37448
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB4640
Species: Hu
Applications: WB
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP3-04538
Species: Hu
Applications: WB, ICC/IF
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-81788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ILKAP/PP2C delta Antibody (NBP2-76549) (0)

There are no publications for ILKAP/PP2C delta Antibody (NBP2-76549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILKAP/PP2C delta Antibody (NBP2-76549) (0)

There are no reviews for ILKAP/PP2C delta Antibody (NBP2-76549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ILKAP/PP2C delta Antibody (NBP2-76549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ILKAP/PP2C delta Products

Bioinformatics Tool for ILKAP/PP2C delta Antibody (NBP2-76549)

Discover related pathways, diseases and genes to ILKAP/PP2C delta Antibody (NBP2-76549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILKAP/PP2C delta Antibody (NBP2-76549)

Discover more about diseases related to ILKAP/PP2C delta Antibody (NBP2-76549).
 

Pathways for ILKAP/PP2C delta Antibody (NBP2-76549)

View related products by pathway.

PTMs for ILKAP/PP2C delta Antibody (NBP2-76549)

Learn more about PTMs related to ILKAP/PP2C delta Antibody (NBP2-76549).
 

Research Areas for ILKAP/PP2C delta Antibody (NBP2-76549)

Find related products by research area.

Blogs on ILKAP/PP2C delta

There are no specific blogs for ILKAP/PP2C delta, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILKAP/PP2C delta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ILKAP
Entrez