IL-27 Antibody (3F12)

Western Blot: IL-27 Antibody (3F12) [H00246778-M01] - IL27 monoclonal antibody (M01), clone 3F12 Analysis of IL27 expression in HeLa.

Western Blot: IL-27 Antibody (3F12) [H00246778-M01] - Analysis of IL27 expression in transfected 293T cell line by IL27 monoclonal antibody (M01), clone 3F12.Lane 1: IL27 transfected lysate(27.5 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: IL-27 Antibody (3F12) [H00246778-M01] - Analysis of IL27 transfected lysate using anti-IL27 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL27 MaxPab rabbit polyclonal antibody.

Product Discontinued

IL-27 Antibody (3F12) Summary

• Immunogen: IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
• Specificity: IL27 - interleukin 27
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IL27
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-27 Antibody (3F12)

• IL-27 p28 subunit
• IL-27 subunit alpha
• IL27
• IL-27
• IL27A
• IL-27-A
• IL27-A
• IL27p28
• IL30
• interleukin 27
• interleukin 30
• interleukin-27 subunit alpha
• MGC71873
• p28IL-27A

Background

The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL27
• Entrez:
  • 246778(Human)
• OMIM:
  • 608273(Human)
• Uniprot:
  • NP_663634()