IL-26/AK155 Antibody - BSA Free

Staining of human cell line JURKAT shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-26/AK155 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-26/AK155 Antibody - BSA Free (NBP3-24912) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein IL-26/AK155 using the following amino acid sequence: NCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-26/AK155 Antibody - BSA Free

• AK155
• AK155IL-26interleukin-26
• IL26
• IL-26
• interleukin 26
• Protein AK155

Background

The IL26 gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL26