IL-20 R beta/FNDC6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IL-20 R beta/FNDC6 Antibody [NBP2-68814] - Staining of human cell line hTCEpi shows localization to cytosol & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-20 R beta/FNDC6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-20 R beta/FNDC6 Antibody - BSA Free (NBP2-68814) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL20RB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  IL-20 R beta/FNDC6 Recombinant Protein Antigen (NBP2-68814PEP)

Reactivity Notes

Mouse 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-20 R beta/FNDC6 Antibody - BSA Free

• FNDC6
• DIRS1
• FNDC6
• IL-20 R beta
• IL20R beta
• IL-20R2
• IL20RB interleukin 20 receptor beta
• IL20RB
• IL-20Rb
• MGC34923

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL20RB