IHPK2 Recombinant Protein Antigen

Images

 
There are currently no images for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IHPK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IHPK2.

Source: E. coli

Amino Acid Sequence: RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IP6K2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68909.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IHPK2 Recombinant Protein Antigen

  • EC 2.7.4.21
  • IHPK2ATP:1D-myo-inositol-hexakisphosphate phosphotransferase
  • inositol hexakisphosphate kinase 2
  • inositol hexaphosphate kinase 2
  • InsP6 kinase 2
  • P(i)-uptake stimulator
  • pi uptake stimulator
  • PIUS

Background

Inositol Hexakisphosphate Kinase 2 encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

8499-IF
Species: Hu
Applications: BA
375-TL
Species: Hu
Applications: BA
NBP1-92026
Species: Hu
Applications: ICC/IF, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-68909PEP
Species: Hu
Applications: AC

Publications for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP) (0)

There are no publications for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP) (0)

There are no reviews for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IHPK2 Products

Research Areas for IHPK2 Recombinant Protein Antigen (NBP2-68909PEP)

Find related products by research area.

Blogs on IHPK2

There are no specific blogs for IHPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IHPK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IP6K2