IGSF4B/SynCAM3/CADM3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ |
| Predicted Species |
Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CADM3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IGSF4B/SynCAM3/CADM3 Antibody - BSA Free
Background
IGSF4B is a brain-specific protein related to the calcium-independent cell-cell adhesion molecules known as nectins (see PVRL3; MIM 607147) (Kakunaga et al., 2005 (PubMed 15741237)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)
There are no publications for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)
There are no reviews for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IGSF4B/SynCAM3/CADM3 Products
Research Areas for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604)
Find related products by research area.
|
Blogs on IGSF4B/SynCAM3/CADM3