IGHMBP2 Antibody - BSA Free

Western Blot: IGHMBP2 Antibody [NBP1-68921] - Mouse Heart.

Immunocytochemistry/Immunofluorescence: IGHMBP2 Antibody [NBP1-68921] - IGHMBP2 in HEK293 cells. Antibody at 1:50. Image from verified customer review.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IGHMBP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2). The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGHMBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml
• Theoretical MW: 109 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IGHMBP2 Antibody - BSA Free

• ATP-dependent helicase IGHMBP2
• CATF1FLJ41171
• EC 3.6.1
• EC 3.6.4.12
• EC 3.6.4.13
• GF-1
• Glial factor 1
• HCSA
• HMN6cardiac transcription factor 1
• immunoglobulin mu binding protein 2
• Immunoglobulin mu-binding protein 2
• SMARD1DNA-binding protein SMUBP-2
• SMBP2
• SMUBP2FLJ34220

Background

Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for IGHMBP2 Antibody (NBP1-68921) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer ICC Human 11/16/2018

Summary

• Application: Immunocytochemistry
• Sample Tested: HEK293
• Species: Human
• Lot: QC8011

Comments

• Comments: 1:50 dilution overnight at 4C in 1X PBS/1% BSA/0.3% Triton™ X-100

Bioinformatics

• Gene Symbol: IGHMBP2
• Uniprot:
  • P40694(Mouse)