PAF49 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PAF49 Antibody [NBP1-90085] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol.
Immunohistochemistry-Paraffin: PAF49 Antibody [NBP1-90085] - Staining of human vagina shows moderate nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAF49 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD3EAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAF49 Protein (NBP1-90085PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAF49 Antibody

  • A34.5
  • antisense to ERCC 1
  • Antisense to ERCC-1 protein
  • ASE-1ASE1
  • CASTMGC118851
  • CD3 epsilon associated protein
  • CD3e antigen, epsilon polypeptide associated protein
  • CD3e molecule, epsilon associated protein
  • CD3E-associated protein
  • CD3-epsilon-associated protein
  • DNA-directed RNA polymerase I subunit RPA34
  • PAF49RNA polymerase I-associated factor PAF49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5175
Species: Mu
Applications: WB, IHC
H00006223-M01
Species: Hu
Applications: WB, ELISA
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90085
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PAF49 Antibody (NBP1-90085) (0)

There are no publications for PAF49 Antibody (NBP1-90085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAF49 Antibody (NBP1-90085) (0)

There are no reviews for PAF49 Antibody (NBP1-90085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAF49 Antibody (NBP1-90085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAF49 Products

Bioinformatics Tool for PAF49 Antibody (NBP1-90085)

Discover related pathways, diseases and genes to PAF49 Antibody (NBP1-90085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAF49 Antibody (NBP1-90085)

Discover more about diseases related to PAF49 Antibody (NBP1-90085).
 

Pathways for PAF49 Antibody (NBP1-90085)

View related products by pathway.

PTMs for PAF49 Antibody (NBP1-90085)

Learn more about PTMs related to PAF49 Antibody (NBP1-90085).

Blogs on PAF49

There are no specific blogs for PAF49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAF49 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3EAP