IGHMBP2 Antibody

Images

 
Western Blot: IGHMBP2 Antibody [NBP1-68921] - ELISA Titer: 1:312500 Positive Control: Mouse Heart

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGHMBP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGHMBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ighmbp2 and was validated on Western blot.
Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGHMBP2 Antibody

  • ATP-dependent helicase IGHMBP2
  • CATF1FLJ41171
  • EC 3.6.1
  • EC 3.6.4.12
  • EC 3.6.4.13
  • GF-1
  • Glial factor 1
  • HCSA
  • HMN6cardiac transcription factor 1
  • immunoglobulin mu binding protein 2
  • Immunoglobulin mu-binding protein 2
  • SMARD1DNA-binding protein SMUBP-2
  • SMBP2
  • SMUBP2FLJ34220

Background

Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00029777-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-68921
Species: Mu
Applications: WB

Publications for IGHMBP2 Antibody (NBP1-68921) (0)

There are no publications for IGHMBP2 Antibody (NBP1-68921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGHMBP2 Antibody (NBP1-68921) (0)

There are no reviews for IGHMBP2 Antibody (NBP1-68921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGHMBP2 Antibody (NBP1-68921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGHMBP2 Products

Bioinformatics Tool for IGHMBP2 Antibody (NBP1-68921)

Discover related pathways, diseases and genes to IGHMBP2 Antibody (NBP1-68921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGHMBP2 Antibody (NBP1-68921)

Discover more about diseases related to IGHMBP2 Antibody (NBP1-68921).
 

Pathways for IGHMBP2 Antibody (NBP1-68921)

View related products by pathway.

PTMs for IGHMBP2 Antibody (NBP1-68921)

Learn more about PTMs related to IGHMBP2 Antibody (NBP1-68921).

Blogs on IGHMBP2

There are no specific blogs for IGHMBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGHMBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGHMBP2
Uniprot