![Western Blot: IGHG1 Antibody [H00003500-B01P] - Analysis of IGHG1 expression in human spleen.](http://images.novusbio.com/fullsize/IGHG1-Antibody-Western-Blot-H00003500-B01P-img0001.jpg "Western Blot: IGHG1 Antibody [H00003500-B01P] - Analysis of IGHG1 expression in human spleen.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IGHG1 (AAH92518.1, 1 a.a. - 469 a.a.) full-length human protein. MEFGLSWVFLVAILKGVQCEVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCATRGGYSTAGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | IGHG1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IGHG1 Antibody (H00003500-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IGHG1 |
![Western Blot: IGHG1 Antibody [H00003500-B01P] - Analysis of IGHG1 expression in transfected 293T cell line by IGHG1 polyclonal antibody. Lane 1: IGHG1 transfected lysate(51.59 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/IGHG1-Antibody-Western-Blot-H00003500-B01P-img0002.jpg "Western Blot: IGHG1 Antibody [H00003500-B01P] - Analysis of IGHG1 expression in transfected 293T cell line by IGHG1 polyclonal antibody. Lane 1: IGHG1 transfected lysate(51.59 KDa). Lane 2: Non-transfected lysate.")
![Control Mouse IgG3 Isotype Control (133316) [Unconjugated]](https://images.novusbio.com/images2/IgG3_MAB007_Control_19774.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![Western Blot alpha 1B-Glycoprotein Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_1BGlycoprotein_AF8537_Western_Blot_16661.jpg)
![Immunocytochemistry alpha 1B-Glycoprotein Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_1BGlycoprotein_AF8537_Immunocytochemistry__Immunofluorescence_16922.jpg)
![Simple Western alpha 1B-Glycoprotein Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_1BGlycoprotein_AF8537_Simple_Western_17657.jpg)
![Simple Western alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Simple_Western_20705.jpg)
![Western Blot alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Western_Blot_20706.jpg)
![Immunocytochemistry alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Immunocytochemistry__Immunofluorescence_17394.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")