IGFLR1/TMEM149 Antibody

Images

 
Western Blot: U2AF1L4 Antibody [NBP1-69417] - This Anti-TMEM149 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFLR1/TMEM149 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM149(transmembrane protein 149) The peptide sequence was selected from the N terminal of TMEM149. Peptide sequence WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFLR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM149 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGFLR1/TMEM149 Antibody

  • FLJ22573
  • IGFLR1
  • TMEM149
  • transmembrane protein 149
  • U2 small nuclear RNA auxiliary factor 1-like 4
  • U2(RNU2) small nuclear RNA auxiliary factor 1-like 4
  • U2AF1L4

Background

TMEM149 is a single-pass type I membrane protein. The exact function of TMEM149 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-33869
Species: Hu
Applications: IHC, IHC-P
NBP1-57317
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-69417
Species: Hu
Applications: WB

Publications for IGFLR1/TMEM149 Antibody (NBP1-69417) (0)

There are no publications for IGFLR1/TMEM149 Antibody (NBP1-69417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFLR1/TMEM149 Antibody (NBP1-69417) (0)

There are no reviews for IGFLR1/TMEM149 Antibody (NBP1-69417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGFLR1/TMEM149 Antibody (NBP1-69417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFLR1/TMEM149 Products

Bioinformatics Tool for IGFLR1/TMEM149 Antibody (NBP1-69417)

Discover related pathways, diseases and genes to IGFLR1/TMEM149 Antibody (NBP1-69417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFLR1/TMEM149 Antibody (NBP1-69417)

Discover more about diseases related to IGFLR1/TMEM149 Antibody (NBP1-69417).

Blogs on IGFLR1/TMEM149

There are no specific blogs for IGFLR1/TMEM149, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFLR1/TMEM149 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFLR1
Entrez
Uniprot