IGFL1 Antibody - BSA Free

Immunohistochemistry: IGFL1 Antibody [NBP2-33869] - Staining of human lung shows distinct positivity in plasma.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IGFL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IGFL1 Antibody - BSA Free (NBP2-33869) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGFL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IGFL1 Recombinant Protein Antigen (NBP2-33869PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IGFL1 Antibody - BSA Free

• APRG644
• IGF-like family member 1
• insulin growth factor-like family member 1
• UNQ644

Background

IGFL1 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play criticalroles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006(PubMed 16890402)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGFL1
• Uniprot:
  • Q6UW32(Human)