IGF2BP3 Recombinant Protein Antigen

Images

 
There are currently no images for IGF2BP3 Protein (NBP1-84339PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IGF2BP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGF2BP3.

Source: E. coli

Amino Acid Sequence: VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGF2BP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84339.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGF2BP3 Recombinant Protein Antigen

  • CT98
  • hKOC
  • IGF II mRNA binding protein 3
  • IGF2 mRNA-binding protein 3
  • IGF-II mRNA-binding protein 3
  • IMP-3KH domain-containing protein overexpressed in cancer
  • IMP3VICKZ family member 3
  • insulin-like growth factor 2 mRNA binding protein 3
  • insulin-like growth factor 2 mRNA-binding protein 3
  • KH domain containing protein overexpressed in cancer
  • KOC1DKFZp686F1078
  • VICKZ3cancer/testis antigen 98

Background

The protein encoded by the IGF2BP3 gene is primarily found in the nucleolus, where it can bind to the 5' UTR of theinsulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during latedevelopment. The encoded protein contains several KH domains, which are important in RNA binding and are known to beinvolved in RNA synthesis and metabolism. A pseudogene exists on chromosome 7, and there are putative pseudogenes onother chromosomes. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
NBP2-38956
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-92389
Species: Hu
Applications: IHC,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-55073
Species: Hu
Applications: ICC/IF, WB
H00196294-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DGB300
Species: Hu
Applications: ELISA
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP3-46482
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-32505
Species: Hu
Applications: IHC,  IHC-P

Publications for IGF2BP3 Protein (NBP1-84339PEP) (0)

There are no publications for IGF2BP3 Protein (NBP1-84339PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP3 Protein (NBP1-84339PEP) (0)

There are no reviews for IGF2BP3 Protein (NBP1-84339PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IGF2BP3 Protein (NBP1-84339PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGF2BP3 Products

Research Areas for IGF2BP3 Protein (NBP1-84339PEP)

Find related products by research area.

Blogs on IGF2BP3

There are no specific blogs for IGF2BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGF2BP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP3