Recombinant Human IgA1 Protein

Images

 
SDS-Page: Recombinant Human IgA1 Protein [H00003493-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human IgA1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 500 of Human IGHA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDWTWSILFLVAAATGAQSQVHLVQSGAEVMSPGASVRVSCKTSGYAFHTYSIIWVRQAPGQGLEWMGWISPSSDNTRFAKKFQGRVTLTTDTSTSTVYMELRSLRSDDTAVYYCARRYCSYSSCQNDYYYYYMDVWGKGTTVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPDRDLCGCYSVSSVLSGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQETIDRLAGKPTHVNVSVVMAEVDGTCY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
IGHA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
80.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IgA1 Protein

  • Arc-1
  • cadherin 1, E-cadherin (epithelial)
  • cadherin 1, type 1, E-cadherin (epithelial)
  • cadherin-1
  • calcium-dependent adhesion protein, epithelial
  • CAM 120/80
  • CD324 antigen
  • CD324
  • CDHE
  • cell-CAM 120/80
  • ECAD
  • E-cadherin
  • Epithelial cadherin
  • LCAM
  • UVOE-Cadherin
  • uvomorulin

Background

MGC27165( AAH05951, 1 a.a. - 501 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88102
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00003493-P02
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for IgA1 Recombinant Protein (H00003493-P02) (0)

There are no publications for IgA1 Recombinant Protein (H00003493-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IgA1 Recombinant Protein (H00003493-P02) (0)

There are no reviews for IgA1 Recombinant Protein (H00003493-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IgA1 Recombinant Protein (H00003493-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IgA1 Products

Bioinformatics Tool for IgA1 Recombinant Protein (H00003493-P02)

Discover related pathways, diseases and genes to IgA1 Recombinant Protein (H00003493-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IgA1 Recombinant Protein (H00003493-P02)

Discover more about diseases related to IgA1 Recombinant Protein (H00003493-P02).
 

Pathways for IgA1 Recombinant Protein (H00003493-P02)

View related products by pathway.

Research Areas for IgA1 Recombinant Protein (H00003493-P02)

Find related products by research area.

Blogs on IgA1

There are no specific blogs for IgA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IgA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGHA1