IFT81 Antibody


Western Blot: IFT81 Antibody [NBP2-87619] - Host: Rabbit. Target Name: IFT81. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IFT81 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human IFT81. Peptide sequence: AIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMEC The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for IFT81 Antibody

  • carnitine deficiency-associated gene expressed in ventricle 1
  • Carnitine deficiency-associated protein expressed in ventricle 1
  • CDV-1
  • CDV1carnitine deficiency-associated, expressed in ventricle 1
  • CDV1R
  • CDV-1R
  • intraflagellar transport 81 homolog (Chlamydomonas)
  • intraflagellar transport protein 81 homolog
  • MGC102777
  • MGC4027


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB

Publications for IFT81 Antibody (NBP2-87619) (0)

There are no publications for IFT81 Antibody (NBP2-87619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT81 Antibody (NBP2-87619) (0)

There are no reviews for IFT81 Antibody (NBP2-87619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFT81 Antibody (NBP2-87619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IFT81 Products

Bioinformatics Tool for IFT81 Antibody (NBP2-87619)

Discover related pathways, diseases and genes to IFT81 Antibody (NBP2-87619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT81 Antibody (NBP2-87619)

Discover more about diseases related to IFT81 Antibody (NBP2-87619).

Pathways for IFT81 Antibody (NBP2-87619)

View related products by pathway.

Blogs on IFT81

There are no specific blogs for IFT81, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IFT81 Antibody and receive a gift card or discount.


Gene Symbol IFT81