IFT20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IFT20 Antibody [NBP1-86424] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.
Immunohistochemistry-Paraffin: IFT20 Antibody [NBP1-86424] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFT20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFT20 Protein (NBP1-86424PEP)
Publications
Read Publication using NBP1-86424.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFT20 Antibody

  • hIFT20
  • intraflagellar transport 20 homolog (Chlamydomonas)
  • intraflagellar transport protein 20 homolog
  • intraflagellar transport protein IFT20

Background

Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in thetrafficking of ciliary membrane proteins from the Golgi complex to the cilium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2475
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NBP2-02313
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55756
Species: Hu
Applications: IHC, IHC-P
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
NB110-55244
Species: Hu, Rt
Applications: ICC/IF, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88332
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-99472
Species: Hu, Mu, Rt
Applications: IHC-P
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
1887-ML
Species: Mu
Applications: BA
NBP1-87772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84534
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
1129-ER
Species: Hu
Applications: BA
NBP1-88467
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC

Publications for IFT20 Antibody (NBP1-86424)(1)

Reviews for IFT20 Antibody (NBP1-86424) (0)

There are no reviews for IFT20 Antibody (NBP1-86424). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFT20 Antibody (NBP1-86424) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT20