IFN-alpha H2/IFNA14 Antibody

Images

 
Western Blot: IFN-alpha H2/IFNA14 Antibody [H00003448-B01P] - Analysis of IFNA14 expression in transfected 293T cell line by IFNA14 polyclonal antibody. Lane 1: IFNA14 transfected lysate(20.79 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-alpha H2/IFNA14 Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
IFNA14 (AAH74956.1, 1 a.a. - 189 a.a.) full-length human protein. MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Specificity
IFNA14 - interferon, alpha 14,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFNA14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha H2/IFNA14 Antibody

  • IFNA14
  • IFNalpha H2
  • IFN-alpha H2
  • IFN-alpha-14
  • IFN-alphaH
  • interferon alpha-14
  • Interferon alpha-H
  • Interferon lambda-2-H
  • interferon, alpha 14
  • LeIF H
  • LEIF2H
  • MGC125756
  • MGC125757

Background

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P) (0)

There are no publications for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P) (0)

There are no reviews for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha H2/IFNA14 Products

Research Areas for IFN-alpha H2/IFNA14 Antibody (H00003448-B01P)

Find related products by research area.

Blogs on IFN-alpha H2/IFNA14

There are no specific blogs for IFN-alpha H2/IFNA14, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha H2/IFNA14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA14
Entrez
Uniprot