IFN-alpha WA/IFNA16 Antibody

Images

 
Western Blot: IFN-alpha WA/IFNA16 Antibody [H00003449-D01P] - Analysis of IFNA16 expression in rat brain.
Western Blot: IFN-alpha WA/IFNA16 Antibody [H00003449-D01P] - Analysis of IFNA16 expression in transfected 293T cell line by IFNA16 polyclonal antibody.Lane 1: IFNA16 transfected lysate(21.70 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFN-alpha WA/IFNA16 Antibody Summary

Immunogen
IFNA16 (NP_002164.1, 1 a.a. - 189 a.a.) full-length human protein. MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
Specificity
Reacts with interferon, alpha 16.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNA16
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha WA/IFNA16 Antibody

  • IFN-alpha-16
  • IFN-alpha-N-protein
  • IFN-alphaO
  • interferon alpha-16
  • Interferon alpha-WA
  • interferon, alpha 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)

There are no publications for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)

There are no reviews for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha WA/IFNA16 Products

Bioinformatics Tool for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P)

Discover related pathways, diseases and genes to IFN-alpha WA/IFNA16 Antibody (H00003449-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P)

Discover more about diseases related to IFN-alpha WA/IFNA16 Antibody (H00003449-D01P).

Blogs on IFN-alpha WA/IFNA16

There are no specific blogs for IFN-alpha WA/IFNA16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha WA/IFNA16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA16
Entrez
Uniprot