IFN-alpha/beta R1 Recombinant Protein Antigen

Images

 
There are currently no images for IFN-alpha/beta R1 Protein (NBP2-38144PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IFN-alpha/beta R1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNAR1.

Source: E. coli

Amino Acid Sequence: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFNAR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38144.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFN-alpha/beta R1 Recombinant Protein Antigen

  • alpha-type antiviral protein
  • AVP
  • beta-type antiviral protein
  • CRF2-1
  • Cytokine receptor class-II member 1
  • Cytokine receptor family 2 member 1
  • human interferon-alpha receptor (HuIFN-alpha-Rec)10IFRC
  • IFN-alpha/beta R1
  • IFN-alpha/beta receptor 1
  • IFN-alpha-REC
  • IFNAR
  • IFNAR1
  • IFN-aR1
  • IFNBR
  • IFNbR1
  • IFN-bR1
  • IFN-R-1
  • interferon (alpha, beta and omega) receptor 1
  • interferon alpha/beta receptor 1
  • interferon-alpha/beta receptor alpha chain
  • interferon-beta receptor 1
  • Type I interferon receptor 1

Background

Interferon alpha receptor 1 (IFN-alpha R1) is a class II cytokine receptor which belongs to type I human interferons (IFNs) family. IFNs plays a role in antiviral, antiproliferative, immunomodulatory, antitumor, and antiparasitic activities by inducing transcription of IFN-stimuated genes (ISGs) through activation of the Jak-STAT pathway. Specifically, IFN- R1 is a 135-kda signal transducing subunit of the IFN alpha/beta receptor complex (IFN-alpha R) (1). IFN-alpha R1 is phospholyated through PTK- and PKC-mediated phosphorylation, which initiates docking of STAT proteins to IFNs. This leads to activation of STAT proteins by PTK-mediated phosphorylation. The mechanism behind the amplification of IFN-alpha R complex mediated transmembrane signaling has been linked to tyrosine phosphorylation on IFN-alpha R1 (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-80261
Applications: ELISA
NBP2-68928
Species: Hu, Rt
Applications: IHC,  IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
9134-TN
Species: Hu
Applications: BA
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
7570-GH
Species: Hu
Applications: EnzAct
DAN00
Species: Hu
Applications: ELISA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr,  IHC-P
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-38144PEP
Species: Hu
Applications: AC

Publications for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)

There are no publications for IFN-alpha/beta R1 Protein (NBP2-38144PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)

There are no reviews for IFN-alpha/beta R1 Protein (NBP2-38144PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFN-alpha/beta R1 Products

Research Areas for IFN-alpha/beta R1 Protein (NBP2-38144PEP)

Find related products by research area.

Blogs on IFN-alpha/beta R1

There are no specific blogs for IFN-alpha/beta R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IFN-alpha/beta R1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNAR1