IFN-alpha/beta R1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNAR1. Source: E. coli
Amino Acid Sequence: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IFNAR1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38144. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IFN-alpha/beta R1 Recombinant Protein Antigen
Background
Interferon alpha receptor 1 (IFN-alpha R1) is a class II cytokine receptor which belongs to type I human interferons (IFNs) family. IFNs plays a role in antiviral, antiproliferative, immunomodulatory, antitumor, and antiparasitic activities by inducing transcription of IFN-stimuated genes (ISGs) through activation of the Jak-STAT pathway. Specifically, IFN- R1 is a 135-kda signal transducing subunit of the IFN alpha/beta receptor complex (IFN-alpha R) (1). IFN-alpha R1 is phospholyated through PTK- and PKC-mediated phosphorylation, which initiates docking of STAT proteins to IFNs. This leads to activation of STAT proteins by PTK-mediated phosphorylation. The mechanism behind the amplification of IFN-alpha R complex mediated transmembrane signaling has been linked to tyrosine phosphorylation on IFN-alpha R1 (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: AC
Publications for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)
There are no publications for IFN-alpha/beta R1 Protein (NBP2-38144PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)
There are no reviews for IFN-alpha/beta R1 Protein (NBP2-38144PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IFN-alpha/beta R1 Protein (NBP2-38144PEP) (0)
Additional IFN-alpha/beta R1 Products
Research Areas for IFN-alpha/beta R1 Protein (NBP2-38144PEP)
Find related products by research area.
|
Blogs on IFN-alpha/beta R1