IFIT2 Recombinant Protein Antigen

Images

 
There are currently no images for IFIT2 Protein (NBP1-85617PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IFIT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFIT2.

Source: E. coli

Amino Acid Sequence: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFIT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85617.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFIT2 Recombinant Protein Antigen

  • cig42
  • G10P2IFI-54K
  • GARG-39
  • IFI-54
  • IFI54IFIT-2
  • IFI-54K
  • Interferon, alpha-inducible protein (MW 54kD)
  • Interferon-induced 54 kDa protein
  • interferon-induced protein 54
  • interferon-induced protein with tetratricopeptide repeats 2
  • ISG-54 K
  • ISG54
  • ISG-54K
  • P54

Background

Saha et al. used this antibody to study protein expression of murine GARG39/IFIT2 in relation to viral infection. Immunofluorescence localized this protein in association with the mitotic spindle in both mitotically active normal NIH3T3 and B16F10 melanoma cells. Western blotting shows approx. 55 kD band GARG39/IFIT2 in brain tissue of mice infected with Japanese encephalitis virus (JEV). Brain tissue from non-infected mice did not display this band. In 1994 Bluyssen et al. characterized the gene for murine GARG39/IFIT2 and historically the protein has been identified as interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), interferon-induced 54 kDa protein (IFI-54K), glucocorticoid-attenuated response gene 39 protein (GARG-39). Human IFIT2, with 62% amino acid sequence identity, has been referred to as Interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), Interferon-induced 54 kDa protein (IFI-54K) and ISG-54 K. Kang et al. showed with proteome analysis IFIT2 was expressed more than two-fold in human osteosarcoma cells U2OS treated with ascochlorin. Kawada et al. studied gene expression to show that IFIT2 is strongly upregulated in peripheral blood in children during the acute phase of influenza.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-02340
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92392
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02148
Species: Hu
Applications: Flow, ICC/IF, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-20329
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB

Publications for IFIT2 Protein (NBP1-85617PEP) (0)

There are no publications for IFIT2 Protein (NBP1-85617PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFIT2 Protein (NBP1-85617PEP) (0)

There are no reviews for IFIT2 Protein (NBP1-85617PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFIT2 Protein (NBP1-85617PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFIT2 Products

Research Areas for IFIT2 Protein (NBP1-85617PEP)

Find related products by research area.

Blogs on IFIT2.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IFIT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIT2