Recombinant Human IFI35 GST (N-Term) Protein

SDS-Page: Recombinant Human IFI35 Protein [H00003430-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human IFI35 GST (N-Term) Protein Summary

• Description: Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-288 of Human IFI35
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: IFI35
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 58.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFI35 GST (N-Term) Protein

• FLJ21753
• ifi-35
• IFP 35
• IFP35interferon-induced 35 kDa protein
• interferon-induced protein 35

Background

IFI35, also known as Interferon-induced 35 kDa protein, consists of 2 isoforms, a 286 amino acid isoform 1 that is 31.5 kDa and a 188 amino acid isoform that is 32 kDa, has nucleus subcellular location and can be found in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Its function is not yet known. Studies of this protein are being performed on research about diverticulitis and ovarian cancer. This protein plays a role in interferon alpha/beta signaling, cytokine signaling in immune system, expression of IFN-induced genes, interferon signaling, and immune system pathways where it interacts with CLEC4G, BATF, PLEKHO1, NMI, and MAPK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IFI35