IFI35 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IFI35 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFI35.

  Source: E. coli

  Amino Acid Sequence: VDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IFI35
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58698.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFI35 Recombinant Protein Antigen

• FLJ21753
• ifi-35
• IFP 35
• IFP35interferon-induced 35 kDa protein
• interferon-induced protein 35

Background

IFI35, also known as Interferon-induced 35 kDa protein, consists of 2 isoforms, a 286 amino acid isoform 1 that is 31.5 kDa and a 188 amino acid isoform that is 32 kDa, has nucleus subcellular location and can be found in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Its function is not yet known. Studies of this protein are being performed on research about diverticulitis and ovarian cancer. This protein plays a role in interferon alpha/beta signaling, cytokine signaling in immune system, expression of IFN-induced genes, interferon signaling, and immune system pathways where it interacts with CLEC4G, BATF, PLEKHO1, NMI, and MAPK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IFI35