IFI35 Antibody

Images

 
Western Blot: IFI35 Antibody [NBP1-52847] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related IFI35 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52847
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IFI35 Antibody Summary

Immunogen
Synthetic peptides corresponding to IFI35(interferon-induced protein 35) Antibody(against the N terminal of IFI35. Peptide sequence MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL.
Clonality
Polyclonal
Host
Rabbit
Gene
IFI35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IFI35 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IFI35 Antibody

  • FLJ21753
  • ifi-35
  • IFP 35
  • IFP35interferon-induced 35 kDa protein
  • interferon-induced protein 35

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
H00009111-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010538-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2570
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-57588
Species: Hu
Applications: WB, ICC/IF
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
H00005956-R02
Species: Hu
NBP1-92569
Species: Hu
Applications: WB, IHC, IHC-P
AF3385
Species: Hu
Applications: WB, IHC
NBP1-52847
Species: Hu
Applications: WB

Publications for IFI35 Antibody (NBP1-52847) (0)

There are no publications for IFI35 Antibody (NBP1-52847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI35 Antibody (NBP1-52847) (0)

There are no reviews for IFI35 Antibody (NBP1-52847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI35 Antibody (NBP1-52847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFI35 Products

Bioinformatics Tool for IFI35 Antibody (NBP1-52847)

Discover related pathways, diseases and genes to IFI35 Antibody (NBP1-52847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI35 Antibody (NBP1-52847)

Discover more about diseases related to IFI35 Antibody (NBP1-52847).
 

Pathways for IFI35 Antibody (NBP1-52847)

View related products by pathway.

PTMs for IFI35 Antibody (NBP1-52847)

Learn more about PTMs related to IFI35 Antibody (NBP1-52847).

Blogs on IFI35

There are no specific blogs for IFI35, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI35
Uniprot