IFI35 Antibody

Product Discontinued

IFI35 Antibody Summary

• Immunogen: Synthetic peptides corresponding to IFI35(interferon-induced protein 35) Antibody(against the N terminal of IFI35. Peptide sequence MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFI35
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against IFI35 and was validated on Western blot.
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IFI35 Antibody

• FLJ21753
• ifi-35
• IFP 35
• IFP35interferon-induced 35 kDa protein
• interferon-induced protein 35

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFI35
• Uniprot:
  • C9JGX1(Human)