IFI35 Antibody

Images

 
Western Blot: IFI35 Antibody [H00003430-B01P] - Analysis of IFI35 expression in human spleen.
Western Blot: IFI35 Antibody [H00003430-B01P] - Analysis of IFI35 expression in transfected 293T cell line by IFI35 polyclonal antibody. Lane 1: IFI35 transfected lysate(31.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFI35 Antibody Summary

Immunogen
IFI35 (NP_005524.1, 1 a.a. - 288 a.a.) full-length human protein. MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFI35
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFI35 Antibody

  • FLJ21753
  • ifi-35
  • IFP 35
  • IFP35interferon-induced 35 kDa protein
  • interferon-induced protein 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
H00009111-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010538-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2570
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-57588
Species: Hu
Applications: WB, ICC/IF
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
H00005956-R02
Species: Hu
NBP1-92569
Species: Hu
Applications: WB, IHC, IHC-P
AF3385
Species: Hu
Applications: WB, IHC
H00003430-B01P
Species: Hu
Applications: WB

Publications for IFI35 Antibody (H00003430-B01P) (0)

There are no publications for IFI35 Antibody (H00003430-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI35 Antibody (H00003430-B01P) (0)

There are no reviews for IFI35 Antibody (H00003430-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI35 Antibody (H00003430-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFI35 Products

Bioinformatics Tool for IFI35 Antibody (H00003430-B01P)

Discover related pathways, diseases and genes to IFI35 Antibody (H00003430-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI35 Antibody (H00003430-B01P)

Discover more about diseases related to IFI35 Antibody (H00003430-B01P).
 

Pathways for IFI35 Antibody (H00003430-B01P)

View related products by pathway.

PTMs for IFI35 Antibody (H00003430-B01P)

Learn more about PTMs related to IFI35 Antibody (H00003430-B01P).

Blogs on IFI35

There are no specific blogs for IFI35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI35
Uniprot