IDH3A Recombinant Protein Antigen

Images

 
There are currently no images for IDH3A Recombinant Protein Antigen (NBP2-57139PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IDH3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IDH3A.

Source: E. coli

Amino Acid Sequence: NKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IDH3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57139.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IDH3A Recombinant Protein Antigen

  • EC 1.1.1
  • EC 1.1.1.41
  • H-IDH alpha
  • isocitrate dehydrogenase (NAD+) alpha chain
  • isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
  • isocitrate dehydrogenase 3 (NAD+) alpha
  • Isocitric dehydrogenase subunit alpha
  • NAD(+)-specific ICDH subunit alpha
  • NAD(H)-specific isocitrate dehydrogenase alpha subunit
  • NAD+-specific ICDH

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NLS1907
Species: Hu
Applications: ICC, IHC,  IHC-P
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
AF1458
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-94321
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7049
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-81351
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-84721
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-19622
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37930
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-48736
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22523
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32011
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for IDH3A Recombinant Protein Antigen (NBP2-57139PEP) (0)

There are no publications for IDH3A Recombinant Protein Antigen (NBP2-57139PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IDH3A Recombinant Protein Antigen (NBP2-57139PEP) (0)

There are no reviews for IDH3A Recombinant Protein Antigen (NBP2-57139PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IDH3A Recombinant Protein Antigen (NBP2-57139PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IDH3A Products

Research Areas for IDH3A Recombinant Protein Antigen (NBP2-57139PEP)

Find related products by research area.

Blogs on IDH3A

There are no specific blogs for IDH3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IDH3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH3A