IBSP/Sialoprotein II Antibody - BSA Free

Western Blot: IBSP/Sialoprotein II Antibody [NBP3-10985] - Western blot analysis of IBSP/Sialoprotein II in Mouse Spleen lysates. Antibody dilution at 1ug/ml

Product Discontinued

IBSP/Sialoprotein II Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IBSP/Sialoprotein II Antibody - BSA Free (NBP3-10985) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse IBSP/Sialoprotein II (NP_032344.2). Peptide sequence MACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IBSP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IBSP/Sialoprotein II Antibody - BSA Free

• BNSP
• Bone sialoprotein 2
• Bone sialoprotein
• BSP 2
• BSP II
• BSP
• BSP2
• BSPII
• BSP-II
• Cell binding sialoprotein
• IBSP
• Integrin binding sialoprotein
• SP II
• SPII
• SP-II

Background

The protein encoded by the Sialoprotein II gene is a major structural protein of the bone matrix. It constitutes approximately 12% ofthe noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophicchondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is thetrophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cellattachment through an RGD sequence that recognizes the vitronectin receptor. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IBSP