HYLS1 Antibody

Images

 
Western Blot: HYLS1 Antibody [NBP1-56899] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HYLS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HYLS1(hydrolethalus syndrome 1) The peptide sequence was selected from the middle region of HYLS1. Peptide sequence YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HYLS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HYLS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HYLS1 Antibody

  • FLJ32915HLS
  • hydrolethalus syndrome 1
  • hydrolethalus syndrome protein 1

Background

This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NB100-2318
Species: Hu
Applications: WB, IP
H00005545-R02
Species: Hu
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NB100-2320
Species: Hu
Applications: IP (-), WB, IP
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14321
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC

Publications for HYLS1 Antibody (NBP1-56899) (0)

There are no publications for HYLS1 Antibody (NBP1-56899).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYLS1 Antibody (NBP1-56899) (0)

There are no reviews for HYLS1 Antibody (NBP1-56899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HYLS1 Antibody (NBP1-56899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HYLS1 Antibody (NBP1-56899)

Discover related pathways, diseases and genes to HYLS1 Antibody (NBP1-56899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HYLS1 Antibody (NBP1-56899)

Discover more about diseases related to HYLS1 Antibody (NBP1-56899).
 

Pathways for HYLS1 Antibody (NBP1-56899)

View related products by pathway.

Blogs on HYLS1

There are no specific blogs for HYLS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYLS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HYLS1
Uniprot