Hydrogen Potassium ATPase Beta Antibody - BSA Free

Western Blot: Hydrogen Potassium ATPase Beta Antibody [NBP1-60028] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Hydrogen Potassium ATPase Beta Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Hydrogen Potassium ATPase Beta Antibody - BSA Free

• ATP4B
• ATP6B
• ATPase, H+/K+ exchanging, beta polypeptide
• ATPase, H+/K+ transporting, beta polypeptide
• Gastric H(+)/K(+) ATPase subunit beta
• gastric H+/K+ ATPase beta subunit
• gastric hydrogen-potassium ATPase, beta
• Hydrogen Potassium ATPase Beta
• potassium-transporting ATPase beta chain
• potassium-transporting ATPase subunit beta
• Proton pump beta chain

Background

ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hydrogen Potassium ATPase Beta Antibody (NBP1-60028)(1)

Publication using NBP1-60028

• Oh JH, Yang JO, Hahn Y et al. Transcriptome analysis of human gastric cancer. Mamm Genome 2005-12-01 [PMID: 16341674]

FAQs for Hydrogen Potassium ATPase Beta Antibody (NBP1-60028). (Showing 1 - 1 of 1 FAQ).

1. What is expression system of this peptide made from? Mammalian cell or bacteria?
   • The lab informed me that the 14aa peptide was generated by our in house peptide synthesizers from individual amino acids, and not from a cell base expression system.

Bioinformatics

• Gene Symbol: ATP4B
• Entrez:
  • 496(Human)
• Uniprot:
  • P51164(Human)