Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164). SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
ATP4B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)
Background
The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Publications for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739) (0)
There are no publications for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739) (0)
There are no reviews for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hydrogen Potassium ATPase Beta Products
Research Areas for Hydrogen Potassium ATPase Beta Antibody (NBP3-15739)
Find related products by research area.
|
Blogs on Hydrogen Potassium ATPase Beta